<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
ACTG364_6007 6007 U.S. 1997 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT+DDC 163
2 AZT+DDC+3TC 97

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, T69D, M184V, L210W, T215Y       V21I, E40F, K43E, K49R, V106I, G196GE, E203K, H208Y, R211K, K223E, L228R, Q278QH, I293V  
>6007| codons 1-297
PISPIETVPVKLKPGMDGPKIKQWPLTEEKIKALVEICTFLEEEGKISRIGPENPYNTPV
FAIKKKDSDKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSITVLDVGDAYFSVPL
DKDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVI
YQYVDDLYVGSDLEIEQHRTKIKELRQYLWKWGFYTPDKKHQEEPPFRWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYAGIKVKHLCKLLRGTKALTEVVPLTE

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    E35ED, N37E, L63P, V77I, I93L  
>6007| codons 1-99
PQITLWQRPLVTIKIGGQLKEALLDTGADDTVLEDMELPGRWKPKMIGGIGGFIKVRQYD
QIPIEICGHKAIGTVLIGPTPVNIIGRNLLTQLGCTLNF

References
Author Title Citation
Albrecht, MA Nelfinavir, efavirenz, or both after the failure of nucleoside treatment of HIV infection.AIDS Clinical Trials Group 364 Study Team. N Engl J Med, 2001