<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
ACTG364_5555 5555 U.S. 1997 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT+DDC 186
2 AZT+DDC+3TC 92

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
D67N, K70R, M184V K219E     K20KR, K64R, S162C, Q207H, R211K, L228R, V245M, K277R, A288S, I293V  
>5555| codons 1-302
PISPIETVPVKLKPGMDGPRVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPV
FAIRKKNSTRWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DKDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQCSMTKILEPFRKQNPDIVI
YQYVDDLYVGSDLEIGQHRTKIEELRHHLLKWGFTTPDEKHQKEPPFRWMGYELHPDKWT
VQPIMLPEKDSWTVNDIQKLVGKLNWASQIYAGIKVRQLCKLLRGTKSLTEVVPLTEEAE
LE

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    G16E, K20R, R57K, L63P, I93L I3S
>5555| codons 1-99
PQSTLWQRPLVTIKIEGQLREALLDTGADDTVLEEMNLPGRWKPKMIGGIGGFIKVKQYD
QIPIEICGHKAIGTVLVGPTPVNIIGRNLLTQLGCTLNF

References
Author Title Citation
Albrecht, MA Nelfinavir, efavirenz, or both after the failure of nucleoside treatment of HIV infection.AIDS Clinical Trials Group 364 Study Team. N Engl J Med, 2001