<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
ACTG364_5109 5109 U.S. 1997 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT+DDI 202
2 AZT+DDI+3TC 86

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41ML, M184MV, T215TNSY       A98AS, K122KE, I135IT, V179I, T200TI, E203D, L228LH, A272AS, I293V, E297Q  
>5109| codons 1-302
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTELEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPSGLKKKKSVTVLDVGDAYFSVPL
DEDFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIII
YQYVDDLYVGSDLEIGQHRIKIDELRQHLLRWGFYTPDKKHQKEPPFHWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYSGIKVKQLCKLLRGTKALTEVVPLTQEAE
LE

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    I13V, N37S  
>5109| codons 1-99
PQITLWQRPLVTVKIGGQLKEALLDTGADDTVLEEMSLPGRWKPKMIGGIGGFIKVRQYD
QILIEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF

References
Author Title Citation
Albrecht, MA Nelfinavir, efavirenz, or both after the failure of nucleoside treatment of HIV infection.AIDS Clinical Trials Group 364 Study Team. N Engl J Med, 2001