<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
ACTG364_5102 5102 U.S. 1997 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 DDI 187
2 AZT+DDI+3TC 85

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M184V V75T, K219KR     K49KR, K101Q, S162D, K166R, T200I, Q207E, R211K, F214L, H221HY, K277R I37L, R143R*
>5102| codons 1-289
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVELCTEMEKEGKISRIGPENPYNTPV
FAIKKKDSTKWRKLTDFRELNKRTQDFWEVQLGIPHPAGLQKKKSVTVLDVGDAYFSVPL
DKDFRKYTAFTIPSINNETPGI*YQYNVLPQGWKGSPAIFQDSMTRILEPFRKQNPDIVI
YQYVDDLYVGSDLEIGQHRIKIEELREHLLKWGLTTPDRKYQKEPPFLWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYAGIKVRQLCKLLRGTKAL

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    I62V, L63P, V77I, I93L  
>5102| codons 1-99
PQITLWQRPLVTIKIGGQLKEALLDTGADDTVLEEMNLPGRWKPKMIGGIGGFIKVRQYD
QVPIEICGHKAIGTVLIGPTPVNIIGRNLLTQLGCTLNF

References
Author Title Citation
Albrecht, MA Nelfinavir, efavirenz, or both after the failure of nucleoside treatment of HIV infection.AIDS Clinical Trials Group 364 Study Team. N Engl J Med, 2001