<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
ACTG364_4975 4975 U.S. 1997 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT+DDC 269

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67DN, L210W, T215Y       V21VI, E44D, V60VI, D121Y, K122E, S162A, D177E, G196GE, T200TA, Q207E, R211K, E248EK  
>4975| codons 1-292
PISPIETVPVKLKPGMDGPKIKQWPLTEEKIKALVEICTELEKDGKISKIGPENPYNTPI
FAIKKKNSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
YEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQASMTKILEPFRKQNPEIVI
YQYMDDLYVGSDLEIEQHRAKIEELREHLWKWGFYTPDKKHQKEPPFLWMGYELHPDKWT
VQPIVLPKKDSWTVNDIQKLVGKLNWASQIYAGIKVKQLCKLLRGTKALTEV

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    Q7QE, L63HPQ, V77I  
>4975| codons 1-99
PQITLWERPLVTIKIGGQLKEALLDTGADDTVLEEMNLPGRWKPKMIGGIGGFIKVRQYD
QIQIEICGHKAIGTVLIGPTPVNIIGRNLLTQIGCTLNF

References
Author Title Citation
Albrecht, MA Nelfinavir, efavirenz, or both after the failure of nucleoside treatment of HIV infection.AIDS Clinical Trials Group 364 Study Team. N Engl J Med, 2001