<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
ACTG364_4803 4803 U.S. 1997 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT 105
2 AZT+DDC 182
3 AZT+3TC 93

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, M184V, L210W, T215Y       K20R, E44D, T69TA, V118VI, D123DN, S162D, K166R, D177E, T200A, Q207E, R211K, V245K, A272P, K277R Y271Y*
>4803| codons 1-286
PISPIETVPVKLKPGMDGPRVKQWPLTEEKIKALVEICTELEKDGKISKIGPENPYNTPV
FAIKKKDSAKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSIPL
DKNFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQDSMTRILEPFRKQNPEIVI
YQYVDDLYVGSDLEIGQHRAKIEELREHLWKWGFYTPDKKHQKEPPFLWMGYELHPDKWT
VQPIKLPEKDSWTVNDIQKLVGKLNWASQI*PGIKVRQLCKLLRGT

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    L10I, Q18L, R41K, I93L  
>4803| codons 1-99
PQITLWQRPIVTIKIGGLLKEALLDTGADDTVLEEMNLPGKWKPKMIGGIGGFIKVRQYD
QILIEICGHKAIGTVLVGPTPVNIIGRNLLTQLGCTLNF

References
Author Title Citation
Albrecht, MA Nelfinavir, efavirenz, or both after the failure of nucleoside treatment of HIV infection.AIDS Clinical Trials Group 364 Study Team. N Engl J Med, 2001