<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
ACTG364_4359 4359 U.S. 1997 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT 12
2 DDI 191
3 AZT+DDI 90

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, K70R, L74V, L210LW, T215Y K219KQ     K64N, R83G, Q207E, R211K, V245M, K277R  
>4359| codons 1-291
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTELEKEGKISKIGPENPYNTPV
FAINKKNSTRWRKVVDFRELNKGTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DKDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVI
YQYMDDLYVGSDLEIGQHRTKIEELREHLWKWGFYTPDQKHQKEPPFLWMGYELHPDKWT
VQPIMLPEKDSWTVNDIQKLVGKLNWASQIYAGIKVRQLCKLLRGTKALTE

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    K43KR, I62V, L63P, I93L  
>4359| codons 10-99
LVTIKIGGQLKEALLDTGADDTVLEEMNLPGRWRPKMIGGIGGFIKVRQYDQVPIEICGH
KAIGTVLVGPTPVNIIGRNLLTQLGCTLNF

References
Author Title Citation
Albrecht, MA Nelfinavir, efavirenz, or both after the failure of nucleoside treatment of HIV infection.AIDS Clinical Trials Group 364 Study Team. N Engl J Med, 2001