<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
ACTG364_3330 3330 U.S. 1997 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 DDI 196
2 AZT+DDI 89

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, T215Y       K64KR, T69S, I142T, T165I, Q207E, V245M, D250E, A272P, Q278QH, I293V, E300X, L301X, A304X  
>3330| codons 1-305
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTELEKEGKISKIGPENPYNTPV
FAIRKKDSSKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DKDFRKYTAFTIPSINNETPGTRYQYNVLPQGWKGSPAIFQSSMIKILEPFRKQNPDIVI
YQYMDDLYVGSDLEIGQHRTKIEELREHLLRWGFYTPDKKHQKEPPFLWMGYELHPDKWT
VQPIMLPEKESWTVNDIQKLVGKLNWASQIYPGIKVKHLCKLLRGTKALTEVVPLTEEAX
XELXE

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    K14R, R41K, I64V, H69Y  
>3330| codons 1-99
PQITLWQRPLVTIRIGGQLKEALLDTGADDTVLEEMNLPGKWKPKMIGGIGGFIKVRQYD
QILVEICGYKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF

References
Author Title Citation
Albrecht, MA Nelfinavir, efavirenz, or both after the failure of nucleoside treatment of HIV infection.AIDS Clinical Trials Group 364 Study Team. N Engl J Med, 2001