<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
ACTG364_308 308 U.S. 1997 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT 6
2 AZT+DDI 173
3 AZT+DDI+3TC 90

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
  L33I Q18L, L19I, N37S, L38F, R41K, L63P, H69HY, Q92K  
>308| codons 1-99
PQITLWQRPLVTIKIGGLIKEALLDTGADDTVIEEMSFPGKWKPKMIGGIGGFIKVRQYD
QIPIEICGYKAIGTVLVGPTPVNIIGRNLLTKIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        K20KR, R211KQ, F214L, S251I  
>308| codons 1-303
PISPIETVPVKLKPGMDGPRVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DKDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVI
YQYMDDLYVGSDLEIGQHRTKIEELRQHLLQWGLTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIVLPEKDIWTVNDIQKLVGKLNWASQIYAGIKVKQLCKLLRGTKALTEVIPLTEEAE
LEL

References
Author Title Citation
Albrecht, MA Nelfinavir, efavirenz, or both after the failure of nucleoside treatment of HIV infection.AIDS Clinical Trials Group 364 Study Team. N Engl J Med, 2001