<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
ACTG364_306 306 U.S. 1997 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT 104
2 DDI 197
3 AZT+DDI 87

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67DN, L210W, T215Y       V35I, K43Q, E44ED, R83K, A98S, K101R, K104KN, V118I, I135T, K166R, E203ED, R211K, K277R  
>306| codons 1-277
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALIEICTELEQDGKISKIGPENPYNTPV
FAIKKKNSTKWRKLVDFRELNKKTQDFWEVQLGIPHPSGLRKKNSVTVLDVGDAYFSIPL
DKDFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQSSMTRILEPFRKQNPDIVI
YQYMDDLYVGSDLEIGQHRTKIDELRQHLWKWGFYTPDKKHQKEPPFLWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYAGIKVR

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    I13IV, K14KR, G16GA, L19I, E35ED, N37S, L63P, H69K, V77I  
>306| codons 1-99
PQITLWQRPLVTVRIAGQIKEALLDTGADDTVLEDMSLPGRWKPKMIGGIGGFIKVRQYD
QIPIEICGKKAIGTVLIGPTPVNIIGRNLLTQIGCTLNF

References
Author Title Citation
Albrecht, MA Nelfinavir, efavirenz, or both after the failure of nucleoside treatment of HIV infection.AIDS Clinical Trials Group 364 Study Team. N Engl J Med, 2001