<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
ACTG364_2253 2253 U.S. 1997 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 DDI 175
2 AZT+DDI+3TC 90

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, L74V, M184V, L210W, T215Y       I31L, E36EA, T39TS, K43EQ, E44EA, K49R, V60VI, I135M, V245M, E297K  
>2253| codons 1-303
PISPIETVPVKLKPGMDGPKVKQWPLTEEKLKALVAICSELEQAGKISRIGPENPYNTPI
FAIKKKDSTKWRKVVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DKDFRKYTAFTIPSMNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVI
YQYVDDLYVGSDLEIGQHRTKIEELRQHLWRWGFYTPDKKHQKEPPFLWMGYELHPDKWT
VQPIMLPEKDSWTVNDIQKLVGKLNWASQIYAGIKVKQLCKLLRGTKALTEVIPLTKEAE
LEL

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    K14R, E35D, M36I, R41K, K43R, I62V, L63P, I72V, V77I  
>2253| codons 1-99
PQITLWQRPLVTIRIGGQLKEALLDTGADDTVLEDINLPGKWRPKMIGGIGGFIKVRQYD
QVPIEICGHKAVGTVLIGPTPVNIIGRNLLTQIGCTLNF

References
Author Title Citation
Albrecht, MA Nelfinavir, efavirenz, or both after the failure of nucleoside treatment of HIV infection.AIDS Clinical Trials Group 364 Study Team. N Engl J Med, 2001