<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
ACTG364_1954 1954 U.S. 1997 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT 376
2 D4T 88

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, T69D, L210W, T215Y       K20R, V35M, K43DE, E44EA, V60I, K104N, V118I, K122E, Q207QE, H208HY, R211K, V245Q, K277R, Q278H, T286A, I293V  
>1954| codons 1-297
PISPIETVPVKLKPGMDGPRVKQWPLTEEKIKALMEICTELEEAGKISKIGPENPYNTPI
FAIKKKNSDKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKNSVTVLDVGDAYFSIPL
DEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVI
YQYMDDLYVGSDLEIGQHRTKIEELREYLWKWGFYTPDKKHQKEPPFLWMGYELHPDKWT
VQPIQLPEKDSWTVNDIQKLVGKLNWASQIYAGIKVRHLCKLLRGAKALTEVVPLTE

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    L10LI  
>1954| codons 1-99
PQITLWQRPIVTIKIGGQLKEALLDTGADDTVLEEMNLPGRWKPKMIGGIGGFIKVRQYD
QILIEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF

References
Author Title Citation
Albrecht, MA Nelfinavir, efavirenz, or both after the failure of nucleoside treatment of HIV infection.AIDS Clinical Trials Group 364 Study Team. N Engl J Med, 2001