<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
ACTG364_1663 1663 U.S. 1997 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 DDI 187
2 AZT+DDI+3TC 88

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, M184V, L210W, T215Y       K43KQ, V179I, E203K, R211K, Q278X, T286A I270IF, L289LV
>1663| codons 1-299
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTELEQEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DKDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIII
YQYVDDLYVGSDLEIGQHRTKIKELRQHLWKWGFYTPDKKHQKEPPFLWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQFYAGIKVKHLCKLLRGAKAVTEVIPLTEEA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    L19V, E35D, M36I, L63P  
>1663| codons 1-99
PQITLWQRPLVTIKIGGQVKEALLDTGADDTVLEDINLPGRWKPKMIGGIGGFIKVRQYD
QIPIEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF

References
Author Title Citation
Albrecht, MA Nelfinavir, efavirenz, or both after the failure of nucleoside treatment of HIV infection.AIDS Clinical Trials Group 364 Study Team. N Engl J Med, 2001