<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
ACTG364_1212 1212 U.S. 1997 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 DDI 167
2 AZT+DDI 94

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
K70R A62V, D67E, V75T, T215TI, K219Q     K20R, T27S, S68G, V118I, K122E, E203D, F214L, L228H, A272P, Q278QE, T286A I37L
>1212| codons 1-297
PISPIETVPVKLKPGMDGPRVKQWPLSEEKIKALVELCTEMEKEGKISKIGPENPYNTPV
FVIKKKEGTRWRKLTDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSIPL
DEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVI
YQYMDDLYVGSDLEIGQHRTKIDELRQHLLRWGLITPDQKHQKEPPFHWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVKELCKLLRGAKALTEVIPLTE

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    I15V, E35D, M36ML, N37S, L63P  
>1212| codons 1-99
PQITLWQRPLVTIKVGGQLKEALLDTGADDTVLEDLSLPGRWKPKMIGGIGGFIKVRQYD
QIPIEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF

References
Author Title Citation
Albrecht, MA Nelfinavir, efavirenz, or both after the failure of nucleoside treatment of HIV infection.AIDS Clinical Trials Group 364 Study Team. N Engl J Med, 2001