<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
ACTG364_1204 1204 U.S. 1997 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT 26
2 DDI 182
3 AZT+DDI+3TC 90

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, L210W, T215Y M184L, K219N     I31IL, R83RK, V90I, V118I, K122P, I135IV, S162CY, I178M, G196E, E203V, A272P, K277R  
>1204| codons 1-292
PISPIETVPVKLKPGMDGPKVKQWPLTEEKLKALVEICTELEKEGKISKIGPENPYNTPV
FAIKKKNSTKWRKLVDFRELNKKTQDFWEIQLGIPHPAGLKKKKSVTVLDVGDAYFSIPL
DPDFRKYTAFTIPSVNNETPGIRYQYNVLPQGWKGSPAIFQYSMTKILEPFRKQNPDMVI
YQYLDDLYVGSDLEIEQHRTKIVELRQHLWRWGFYTPDNKHQKEPPFLWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKALTEV

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    T12I, I15V, E35D, N37D, R41K, I62V, L63P  
>1204| codons 1-99
PQITLWQRPLVIIKVGGQLKEALLDTGADDTVLEDMDLPGKWKPKMIGGIGGFIKVRQYD
QVPIEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF

References
Author Title Citation
Albrecht, MA Nelfinavir, efavirenz, or both after the failure of nucleoside treatment of HIV infection.AIDS Clinical Trials Group 364 Study Team. N Engl J Med, 2001