<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA22109 CA51129 U.S. 2004 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 NNRTI+NRTI 48
2 ABC+DDI+NVP+TDF 29

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, L74V, T215Y   Y181V   K20R, K32KQ, E53ED, I135T, Q145QR, R211K, K249R P59PS
>CA51129| codons 1-262
PISPIETVPVKLKPGMDGPRVKQWPLTEEKIQALVEICTELEKEGKISKIGPDNPYNTSV
FAIKKKDSTKWRKVVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DKDFRKYTAFTIPSTNNETPGIRYRYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVI
VQYMDDLYVGSDLEIGQHRTKIEELRQHLLKWGFYTPDKKHQKEPPFLWMGYELHPDKWT
VQPIVLPERDSWTVNDIQKLVG

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    T12S, L19T, K45R, V77I, I93L  
>CA51128| codons 1-99
PQITLWQRPLVSIKIGGQTKEALLDTGADDTVLEEMNLPGRWKPRMIGGIGGFIKVRQYD
QILIEICGHKAIGTVLIGPTPVNIIGRNLLTQLGCTLNF

References
Author Title Citation
Melikian, GL Standardized comparison of the relative impacts of HIV-1 reverse transcriptase (RT) mutations on nucleoside RT inhibitor susceptibility. AAC, 2012