<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA22108 CA51127 U.S. 2004 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 3TC+D4T+EFV 89

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M184V, T215TFIS   L100I, K103N V108VI, K238KT K122R, D123E, I135V, T139TR, S162C, K173R, Q174K, D177E, T200A, R211K, F214FL, E248D  
>CA51127| codons 1-261
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGIKKNKSVTILDVGDAYFSVPL
DREFRKYTAFTIPSVNNERPGIRYQYNVLPQGWKGSPAIFQCSMTKILEPFRRKNPEIVI
YQYVDDLYVGSDLEIGQHRAKIEELRQHLLKWGLSTPDKKHQKEPPFLWMGYELHPDTWT
VQPIVLPDKDSWTVNDIQKLV

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    I13V, L19I, L63P, I64L, A71T, I72V, V77I  
>CA51126| codons 1-99
PQITLWQRPLVTVKIGGQIKEALLDTGADDTVLEEMNLPGRWKPKMIGGIGGFIKVRQYD
QIPLEICGHKTVGTVLIGPTPVNIIGRNLLTQIGCTLNF

References
Author Title Citation
Rhee, SY Predictive value of HIV-1 genotypic resistance test interpretation algorithms. J Infect Dis, 2009