<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA22088 CA51085 U.S. 2004 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 3TC+D4T+NVP 4
2 None 24
3 3TC+DDI+TDF 75

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
K70EQ, M184V       E36EK, V90I, D177E, V179I, G196E, I202V, E204K, R211Q, A272P, L283LI, V292I, I293V, P294Q, E297K, A304E, V317A, A327V, I329V, M357T  
>CA51085| codons 1-368
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVKICTEMEKEGKISKIGPENPYNTPV
FAIKKKDSTQWRKLVDFRELNKRTQDFWEIQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DKDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPEIII
YQYVDDLYVGSDLEIEQHRTKVEKLRQHLLQWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVKQLCKLIRGTKALTEIVQLTKEAE
LELEENREILKEPVHGAYYDPSKDLIVEVQKQGQGQWTYQIYQEPFKNLKTGKYARTRGA
HTNDVKQL

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    E35D, N37D, K43R, R57K, L63P, A71T, I93L  
>CA51084| codons 1-99
PQITLWQRPLVTIKIGGQLKEALLDTGADDTVLEDMDLPGRWRPKMIGGIGGFIKVKQYD
QIPIEICGHKTIGTVLVGPTPVNIIGRNLLTQLGCTLNF

References
Author Title Citation
Rhee, SY Predictive value of HIV-1 genotypic resistance test interpretation algorithms. J Infect Dis, 2009