<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA22062 CA51032 U.S. 2004 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 3TC+AZT+IDV 143
2 3TC+AZT+NFV 242

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
D30N, M46I, L90LM L10F, N88D T12I, I13V, I15V, R57K, I62V, L63P, V77I, I93L  
>CA51032| codons 1-99
PQITLWQRPFVIVKVGGQLKEALLDTGADNTVLEEMNLPGRWKPKIIGGIGGFIKVKQYD
QVPIEICGHKAIGTVLIGPTPVNIIGRDLMTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, M184V, L210W, T215Y K219KN     K43E, E44EAD, T69TA, V118I, K122E, I135L, T200A, Q207E, H208Y, R211K, A272P, K277R, L283I, E297R  
>CA51033| codons 1-301
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTELEEDGKISKIGPENPYNTPV
FAIKKKNSAKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSIPL
DEDFRKYTAFTIPSLNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVI
YQYVDDLYVGSDLEIGQHRAKIEELREYLWKWGFYTPDNKHQKEPPFLWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLIRGTKALTEVIPLTREAE
L

References
Author Title Citation
Mitsuya, Y N88D facilitates the co-occurrence of D30N and L90M and the development of multidrug resistance in HIV type 1 protease following nelfinavir treatment failure. ARHR, 2006