<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
JCS-C1 C1B Spain 1995 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 DDI+ AZT 24

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, K70R, T215Y       K20R, V35T, V60I, A98S, K104N, E138A, E169D, I178M, H208Y, R211K  
>C1B| codons 1-259
PISPIETVPVKLKPGMDGPRVKQWPLTEEKIKALTEICTELEKEGKISKIGPENPYNTPI
FAIKKKNSTRWRKLVDFRELNKRTQDFWEVQLGIPHPSGLKKKNSVTVLDVGDAYFSVPL
DKDFRKYTAFTIPSINNATPGIRYQYNVLPQGWKGSPAIFQSSMTKILDPFRKQNPDMVI
YQYMDDLYVGSDLEIGQHRTKIEELRQYLLKWGFYTPDKKHQKEPPFLWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQK

References
Author Title Citation
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005
Ruiz, L Efficacy of triple combination therapy with zidovudine (ZDV) plus zalcitabine (ddC) plus lamivudine (3TC) versus double (ZDV+3TC) combination therapy in patients previously treated with ZDV+ddC. AIDS, 1996