<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA16508 CA50975 U.S. 2004 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT 39
2 3TC+AZT 100
3 D4T+NFV+NVP 345

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
D67N, K70R, T215F K219Q K103N, Y181C   L34I, V35T, T39A, V60VI, V118I, K122E, D123N, I135T, I178L, E203D, R211K, F214L, L228H, V245M, K277R, T286TA, I293V, I329V, Q334E, R358K  
>CA50975| codons 1-367
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKAITEICAEMEKEGKISKIGPENPYNTPI
FAIKKKNSTRWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKNKSVTVLDVGDAYFSIPL
DENFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDLVI
CQYMDDLYVGSDLEIGQHRTKIDELRQHLLKWGLFTPDQKHQKEPPFHWMGYELHPDKWT
VQPIMLPEKDSWTVNDIQKLVGKLNWASQIYAGIKVRQLCKLLRGAKALTEVVPLTEEAE
LELAENREILKEPVHGVYYDPSKDLIAEVQKQGEGQWTYQIYQEPFKNLKTGKYARMKGA
HTNDVKQ

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
D30N N88D I13V, E35ED, N37S, D60E, L63P, A71T, V77I  
>CA50974| codons 1-99
PQITLWQRPLVTVKIGGQLKEALLDTGADNTVLEDMSLPGRWKPKMIGGIGGFIKVRQYE
QIPIEICGHKTIGTVLIGPTPVNIIGRDLLTQIGCTLNF

References
Author Title Citation
Rhee, SY Predictive value of HIV-1 genotypic resistance test interpretation algorithms. J Infect Dis, 2009