<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
JCS-C13 C13W24 Spain 1996 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT+ DDI 24
2 3TC+ AZT 24

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
K65R, Q151M, M184V V75I, F77L, F116Y     V35M, T39K, K43E, S68G, T69I, K70X, K102Q, K122E, K166R, T200A, R211G, V245E, D250E  
>C13W24| codons 1-259
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALMEICKEMEEEGKISKIGPENPYNTPV
FAIKRKDGIXWRKLIDLRELNKRTQDFWEVQLGIPHPAGLKQKKSVTVLDVGDAYYSVPL
DEDFRKYTAFTIPSINNETPGIRYQYNVLPMGWKGSPAIFQSSMTRILEPFRKQNPDIVI
YQYVDDLYVGSDLEIGQHRAKIEELRQHLLGWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIELPEKESWTVNDIQK

References
Author Title Citation
Gonzales, MJ Extended spectrum of HIV-1 reverse transcriptase mutations in patients receiving multiple nucleoside analog inhibitors. AIDS, 2003
Ruiz, L Efficacy of triple combination therapy with zidovudine (ZDV) plus zalcitabine (ddC) plus lamivudine (3TC) versus double (ZDV+3TC) combination therapy in patients previously treated with ZDV+ddC. AIDS, 1996
Rhee, SY HIV-1 Protease and Reverse Transcriptase Mutations: Correlations with Antiretroviral Therapy in Subtype B Isolates and Implications for Drug-Resistance Surveillance. J Infect Dis, 2005