<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA8331 CA50906 U.S. 2004 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 D4T+DDI+LPV 43
2 ABC+LPV+TDF 26
3 None 48
4 3TC+ABC+ATV+RTV+TDF 29

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, I54V, V82T, I84V   L10I, K14R, I15V, K20I, R41I, D60N, I62V, L63P, I64V, A71V, I85V  
>CA50906| codons 1-99
PQITLWQRPIVTIRVGGQLIEALLDTGADDTVLEEMNLPGIWKPKIIGGIGGFVKVRQYN
QVPVEICGHKVIGTVLVGPTPTNVVGRNLLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
D67N, K70R, M184V, T215Y K219E     K64R, I135T, V179I, Q197K, T200A, Q207D, R211K, V245K, K277R, I293V  
>CA50907| codons 1-301
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPV
FAIRKKNSTRWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DKDFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIII
YQYVDDLYVGSDLEIGKHRAKIEELRDHLLKWGFYTPDEKHQKEPPFLWMGYELHPDKWT
VQPIKLPEKDSWTVNDIQKLVGKLNWASQIYAGIKVRQLCKLLRGTKALTEVVPLTEEAE
L

References
Author Title Citation
Rhee, SY Genotypic predictors of human immunodeficiency virus type 1 drug resistance. PNAS, 2006
Rhee, SY Predictive value of HIV-1 genotypic resistance test interpretation algorithms. J Infect Dis, 2009