<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA1833 CA50895 U.S. 2004 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT 44
2 D4T 87
3 3TC+AZT+IDV 42
4 3TC+D4T+IDV 26
5 DDC+NFV+NVP 47
6 DDC+RTV+SQV 31
7 ABC+EFV+RTV+SQV 38
8 APV+D4T+EFV+RTV 28
9 3TC+APV+D4T+DDI+RTV 228

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, T69D, M184V, L210W, T215Y   K101EQ, Y181C, G190A A98G, V108I K20R, T39E, E40EK, E44D, V118I, K122E, I135T, T165TI, R172RK, G196E, E203K, H208Y, R211K, H221Y, A272S, V276T, K277R, Q278E, L283I, I293V, P294S, E297K  
>CA50895| codons 1-300
PISPIETVPVKLKPGMDGPRVKQWPLTEEKIKALVEICEKLEKDGKISKIGPENPYNTPV
FAIKKKNSDKWRKLVDFRELNKRTQDFWEVQLGIPHPGGLQKKKSVTILDVGDAYFSIPL
DEDFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQSSMIKILEPFKKQNPDIVI
CQYVDDLYVASDLEIEQHRTKIKELRQYLWKWGFYTPDKKYQKEPPFLWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYSGIKTRELCKLIRGTKALTEVVSLTKEAE

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46L, G48M, I54M, V82A, I84V V11VI, L33F L10I, T12P, I13V, K14R, L19V, L63T, A71V, I72T, T74A, P79PS, I93L  
>CA50894| codons 1-99
PQITLWQRPIIPVRIGGQVKEALLDTGADDTVFEEMNLPGRWKPKLIMGIGGFMKVRQYD
QITIEICGHKVTGAVLVGSTPANVIGRNLLTQLGCTLNF

References
Author Title Citation
Rhee, SY Predictive value of HIV-1 genotypic resistance test interpretation algorithms. J Infect Dis, 2009