<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA4303 CA50892 U.S. 2004 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT+DDC 52
2 DDI 48
3 3TC+AZT 18
4 3TC+AZT+IDV 168
5 ABC+D4T+EFV 28
6 3TC+ABC+D4T 44
7 3TC+D4T+LPV 44
8 3TC+D4T+LPV+TDF 35
9 3TC+D4T+LPV+T20+TDF 31
10 3TC+D4T+LPV+TDF 80

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46L, I54V, L76V, V82A   L10I, I15V, G16A, K20R, E35D, M36I, N37D, K55R, R57K, I62V, L63P, A71V, I93L  
>CA50892| codons 1-99
PQITLWQRPIVTIKVAGQLREALLDTGADDTVLEDIDLPGRWKPKLIGGIGGFVRVKQYD
QVPIEICGHKVIGTVVVGPTPANIIGRNLLTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, L74I, M184V, L210W, T215Y       K20R, E44D, V118I, I135T, S162SDGN, K173E, Q174K, D177E, G196GE, Q197E, K201KR, I202V, E203EK, Q207E, H208Y, R211K, H221C, V245K, A272P, K277KR, R284K, T286A, I293V, E297K K43KHNQ
>CA50893| codons 1-300
PISPIETVPVKLKPGMDGPRVKQWPLTEEKIKALVEICTELEQDGKISKIGPENPYNTPV
FAIKKKNSTKWRKIVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSIPL
DKDFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQNSMTKILEPFREKNPEIVI
YQYVDDLYVGSDLEIEEHRTRVKELREYLWKWGFYTPDKKCQKEPPFLWMGYELHPDKWT
VQPIKLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLKGAKALTEVVPLTKEAE

References
Author Title Citation
Rhee, SY Genotypic predictors of human immunodeficiency virus type 1 drug resistance. PNAS, 2006
Rhee, SY Predictive value of HIV-1 genotypic resistance test interpretation algorithms. J Infect Dis, 2009