<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA3979 CA50876 U.S. 2004 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT 161
2 3TC+AZT+IDV 13
3 3TC+AZT+SQV 26
4 3TC+AZT+NFV 65
5 3TC+DDI+NVP+RTV+SQV 45
6 None 25
7 ABC+D4T+LPV 248

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, I54V, I84V, L90M L10F I13IM, I15V, K20I, M36I, I62V, L63P, H69T, A71T, I72V, Q92QR  
>CA50876| codons 1-99
PQITLWQRPFVTMKVGGQLIEALLDTGADDTVLEEINLPGRWKPKIIGGIGGFVKVRQYD
QVPIEICGTKTVGTVLVGPTPVNVIGRNLMTRIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
D67N, K70R, M184MV T215I, K219EQ K103N   K20R, K49KR, T69N, R83RK, K122E, D123E, D177E, I178M, F214L, V245E, A272P, E297K  
>CA50877| codons 1-300
PISPIETVPVKLKPGMDGPRVKQWPLTEEKIKALVEICTEMEKEGKISRIGPENPYNTPV
FAIKKKNSNRWRKLVDFRELNKKTQDFWEVQLGIPHPAGLKKNKSVTVLDVGDAYFSVPL
DEEFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPEMVI
YQYVDDLYVGSDLEIGQHRTKIEELRQHLLRWGLITPDQKHQKEPPFLWMGYELHPDKWT
VQPIELPEKDSWTVNDIQKLVGKLNWASQIYPGIKVKQLCKLLRGTKALTEVIPLTKEAE

References
Author Title Citation
Mitsuya, Y N88D facilitates the co-occurrence of D30N and L90M and the development of multidrug resistance in HIV type 1 protease following nelfinavir treatment failure. ARHR, 2006