<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA1270 CA5085 U.S. 1998 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT 52
2 DDI 52
3 3TC 52
4 D4T 36
5 AZT+SQV 52
6 NVP 52
7 AZT+IDV 24
8 D4T+RTV+SQV 29
9 3TC+D4T+RTV+SQV 30
10 3TC+D4T+IDV 11

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
I84V, L90M G73S K20I, N37D, L63P, A71V, I85V  
>CA5085| codons 1-99
PQITLWQRPLVTIKIGGQLIEALLDTGADDTVLEEMDLPGRWKPKMIGGIGGFIKVRQYD
QIPIEICGHKVISTVLVGPTPVNVVGRNLMTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, M184I, L210W, T215Y   K101E, G190A   E44D, W88S, K166I, R211K  
>CA5084| codons 1-264
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTELEKDGKISKIGPENPYNTPV
FAIKKKNSTKWRKLVDFRELNKRTQDFSEVQLGIPHPAGLEKKKSVTVLDVGDAYFSVPL
DKDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTIILEPFRKQNPDIVI
YQYIDDLYVASDLEIGQHRTKIEELRQHLWKWGFYTPDKKHQKEPPFLWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKL

References
Author Title Citation
Wu, TD Mutation patterns and structural correlates in human immunodeficiency virus type 1 protease following different protease inhibitor treatments. J Virol, 2003
Gonzales, MJ Protease and reverse transcriptase mutation patterns in HIV-1 isolates from heavily treated persons: comparison of isolates from northern California with isolates from other regions. ARHR, 2003
Rhee, SY HIV-1 Protease and Reverse Transcriptase Mutations: Correlations with Antiretroviral Therapy in Subtype B Isolates and Implications for Drug-Resistance Surveillance. J Infect Dis, 2005