<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA1850 CA50801 U.S. 2004 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 3TC+AZT+IDV 80
2 D4T+NVP+RTV 65
3 ABC+APV+D4T+RTV 271

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, K70R, L210W, T215Y K219E, N348I K103N, Y181C   E6D, T7P, E44D, V60I, K66KR, A98S, K101Q, K122P, I135V, D177E, V179VAIT, R211K, L228R, A272P, K277R, I293V, E297A, I326V, G359S, K366R, I375V, T386I, T403MR, L469I, T470V, H483Y, K527N  
>CA50801| codons 1-560
PISPIDPVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTELEKDGKISKIGPENPYNTPI
FAIKKRNSTRWRKLVDFRELNKRTQDFWEVQLGIPHPSGLQKNKSVTVLDVGDAYFSVPL
DPDFRKYTAFTIPSVNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPEITI
CQYMDDLYVGSDLEIGQHRTKIEELRQHLWKWGFYTPDEKHQKEPPFRWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKALTEVVPLTAEAE
LELAENREILKEPVHGVYYDPSKDLVAEIQKQGQGQWTYQIYQEPFKILKTGKYARMRSA
HTNDVRQLTEAVQKVATESIVIWGKIPKFKLPIQKETWEAWWREYWQATWIPEWEFVNTP
PLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTDRGRQKVVSIVDTTNQKTELQ
AIYLALQDSGLEVNIVTDSQYALGIIQAQPDKSESELVSQIIEQLINKEKVYLAWVPAHK
GIGGNEQVDKLVSAGIRKVL

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
V32I, M46I, I54M, V82A, L90M L33F, K43T L10I, D60E, L63P, I64M, A71V, L89M, I93L  
>CA50800| codons 1-99
PQITLWQRPIVTIKIGGQLKEALLDTGADDTIFEEMNLPGRWTPKIIGGIGGFMKVRQYE
QIPMEICGHKVIGTVLVGPTPANIIGRNMMTQLGCTLNF

References
Author Title Citation
Rhee, SY Predictive value of HIV-1 genotypic resistance test interpretation algorithms. J Infect Dis, 2009