<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA5204 CA50796 U.S. 2004 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 3TC+AZT 96
2 D4T+NFV+NVP 49
3 DDI+RTV+SQV 155
4 3TC+AZT+LPV 100

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
I84V, L90M L10LF, L23I, N88D I13IV, G16A, K20R, M36I, R57K, Q61H, L63P, H69Q, A71I, I93M  
>CA50796| codons 1-99
PQITLWQRPFVTVKIAGQLREAILDTGADDTVLEEINLPGRWKPKMIGGIGGFIKVKQYD
HIPIEICGQKIIGTVLVGPTPVNVIGRDLMTQMGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M184V   K103N   K20R, K49R, K122E, I135T, E169D, V179VI, T200TA, A400S, E404D, E432D, V435A, Q520K, K527N, E546EK, A554N  
>CA50797| codons 1-560
PISPIETVPVKLKPGMDGPRVKQWPLTEEKIKALVEICTEMEKEGKISRIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKNKSVTVLDVGDAYFSVPL
DEDFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILDPFRKQNPDIII
YQYVDDLYVGSDLEIGQHRAKIEELRQHLLRWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYAGIKVKQLCKLLRGTKALTEVIPLTEEAE
LELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGA
HTNDVKQLTEAVQKIATESIVIWGKTPKFKLPIQKETWESWWTDYWQATWIPEWEFVNTP
PLVKLWYQLEKDPIAGAETFYVDGAANRETKLGKAGYVTDRGRQKVVSLTDTTNQKTELQ
AIHLALQDSGLEVNIVTDSQYALGIIQAQPDKSESELVSKIIEQLINKEKVYLAWVPAHK
GIGGNKQVDKLVSNGIRKVL

References
Author Title Citation
Rhee, SY Predictive value of HIV-1 genotypic resistance test interpretation algorithms. J Infect Dis, 2009