<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA5951 CA50780 U.S. 2004 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT 113
2 3TC+AZT 9
3 3TC+AZT+IDV 52
4 3TC+D4T+NVP 57
5 None 187
6 3TC+ABC+D4T+LPV 26
7 None 12
8 3TC+ABC+D4T+LPV 97

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
V32I, M46L, I47A, V82A L33F L10I, T12P, L19I, E35D, M36I, L63P, I64V, A71V, I72V, I93L  
>CA50780| codons 1-99
PQITLWQRPIVPIKIGGQIKEALLDTGADDTIFEDINLPGRWKPKLAGGIGGFIKVRQYD
QIPVEICGHKVVGTVLVGPTPANIIGRNLLTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, M184V, L210W, T215Y       K32N, V35K, T39A, K49KR, R83RK, K122E, K173Q, Q174K, I178M, E203K, R211Q, K223Q, A272P, R284K, T286A  
>CA50781| codons 1-333
PISPIETVPVKLKPGMDGPKVKQWPLTEEKINALKEICAELEKEGKISRIGPENPYNTPV
FAIKKKNSTKWRKLVDFRELNKKTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRQKNPDMVI
YQYVDDLYVGSDLEIGQHRTKIKELRQHLWQWGFYTPDKKHQQEPPFLWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVKQLCKLLKGAKALTEVIPLTEEAE
LELAENREILKEPVHGVYYDPSKDLIAEIQKQG

References
Author Title Citation
Rhee, SY Predictive value of HIV-1 genotypic resistance test interpretation algorithms. J Infect Dis, 2009