<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA794 CA5077 U.S. 1998 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT 78
2 DDI 43
3 DDC 13
4 D4T 30
5 AZT+D4T 18
6 3TC+AZT+IDV 52
7 D4T+DDI+NVP 19
8 3TC+D4T+RTV+SQV 58
9 3TC+DDI+EFV+RTV+SQV 17

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, K65R, D67N, Q151M, L210W, T215Y A62V, V75I, F116Y L100I, K103KN, Y181I V179D M16V, K20R, V21I, V35I, K43Q, S68N, E79D, R83K, K122E, I167V, G196E, Q197K, D218E, K223Q, L228R, A272P, K277R  
>CA5077| codons 1-302
PISPIETVPVKLKPGVDGPRIKQWPLTEEKIKALIEICTELEQEGKISKIGPENPYNTPV
FVIKRKNNTKWRKLIDFRDLNKKTQDFWEVQLGIPHPAGIKKNKSVTVLDVGDAYYSVPL
DEDFRKYTAFTIPSINNETPGIRYQYNVLPMGWKGSPAIFQSSMTKVLEPFRKQNPDIDI
IQYMDDLYVGSDLEIEKHRTKIEELRQHLWRWGFYTPEKKHQQEPPFRWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKALTEVIPLTEEAE
LE

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46L, I54V, V82A, I84V, L90M K43T L10I, E35D, M36V, D60E, I62V, L63P, A71V  
>CA5076| codons 1-99
PQITLWQRPIVTIKIGGQLKEALLDTGADDTVLEDVNLPGRWTPKLIGGIGGFVKVRQYE
QVPIEICGHKVIGTVLVGPTPANVIGRNLMTQIGCTLNF

References
Author Title Citation
Shulman, NS Efavirenz- and adefovir dipivoxil-based salvage therapy in highly treatment-experienced patients: Clinical and genotypic predictors of virologic response. JAIDS, 2000
Gonzales, MJ Extended spectrum of HIV-1 reverse transcriptase mutations in patients receiving multiple nucleoside analog inhibitors. AIDS, 2003
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005