<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
q759 q759 U.S. 1999 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 NRTI+ NNRTI NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
D67N, T69~, Y115F, Q151M, M184V A62V, V75I, F77L, F116Y, K219E K101E, Y181C, G190A   V35L, S68G, K122E, I135T, R172K, E203EQ, R211K  
>q759| codons 1-273
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALLEICTEMEKEGKISKIGPENPYNTPV
FVIKKKNG~KWRKLIDLRELNKRTQDFWEVQLGIPHPAGLEKKKSVTVLDVGDAFYSVPL
DEDFRKYTAFTIPSTNNETPGIRYQYNVLPMGWKGSPAIFQSSMTKILEPFKKQNPDIVI
CQYVDDLYVASDLEIGQHRTKIQELRQHLLKWGFTTPDEKHQKEPPFLWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYAG

References
Author Title Citation
Winters, MA Genotypic, phenotypic, and modeling studies of a deletion in the beta3-beta4 region of the human immunodeficiency virus type 1 reverse transcriptase gene that is associated with resistance to nucleoside reverse transcriptase inhibitors. J Virol, 2000