<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA1157 CA5071 U.S. 1998 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT 13
2 AZT+ DDC 247
3 DDI 30
4 D4T 8
5 3TC+ D4T 8
6 3TC+ D4T+ SQV 13
7 3TC+ D4T+ IDV 107

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, T69D, M184V, L210W, T215Y A62V, K219KR     K20R, V35I, K43E, E44A, V118I, K122E, I135T, R211K, L228H  
>CA5071| codons 1-258
PISPIETVPVKLKPGMDGPRVKQWPLTEEKIKALIEICTELEEAGKISKIGPENPYNTPV
FVIKKKNSDKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSIPL
DEDFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVI
YQYVDDLYVGSDLEIGQHRTKIEELRQHLWKWGFYTPDRKHQKEPPFHWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQ

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, I84V, L90M G73S L10I, I13V, K14R, N37D, L63P, A71V, I72IL, V77I, I85V  
>CA5070| codons 1-99
PQITLWQRPIVTVRIGGQLKEALLDTGADDTVLEEMDLPGRWKPKIIGGIGGFIKVRQYD
QIPIEICGHKVLSTVLIGPTPVNVVGRNLMTQIGCTLNF

References
Author Title Citation
Gonzales, MJ Extended spectrum of HIV-1 reverse transcriptase mutations in patients receiving multiple nucleoside analog inhibitors. AIDS, 2003
Gonzales, MJ Protease and reverse transcriptase mutation patterns in HIV-1 isolates from heavily treated persons: comparison of isolates from northern California with isolates from other regions. ARHR, 2003
Rhee, SY HIV-1 Protease and Reverse Transcriptase Mutations: Correlations with Antiretroviral Therapy in Subtype B Isolates and Implications for Drug-Resistance Surveillance. J Infect Dis, 2005