<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
SA62_1069 1069_6W South Africa 2000 HIV1 C Plasma None

Treatment History
Order Regimen Weeks
1 D4T 6

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        V35T, E36A, T39E, E40D, S48T, V60I, K122E, K173A, D177E, T200A, Q207E, R211K, F214L, V245Q, A272S, K277R, E291D, V292I, I293V  
>1069_6W| codons 10-313
VKLKPGMDGPKVKQWPLTEEKIKALTAICEDMEKEGKITKIGPENPYNTPIFAIKKKDST
KWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTA
FTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRAQNPEIVIYQYMDDLYV
GSDLEIGQHRAKIEELREHLLKWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIQLPEK
DSWTVNDIQKLVGKLNWASQIYSGIKVRQLCKLLRGTKALTDIVPLTEEAELELAENREI
LKEP

References
Author Title Citation
Non-B Workgroup Impact of HIV-1 subtype and antiretroviral therapy on protease and reverse transcriptase genotype: Results of a global collaboration. PLoS Med, 2005