<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
SA41_1034 1034_6M South Africa 2000 HIV1 C Plasma None

Treatment History
Order Regimen Weeks
1 DDI 6
2 DDI+ D4T 20

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
      A98G V35T, E36V, T39E, S48T, V60I, K104R, K122E, D123S, I135M, K173T, T200A, Q207E, V245Q, D250E, A272P, K275R, K277R, Q278H, T286A, E291D, V292I, I293V  
>1034_6M| codons 10-317
VKLKPGMDGPKVKQWPLTEEKIKALTVICEEMEKEGKITKIGPENPYNTPIFAIKKKDST
KWRKLVDFRELNKRTQDFWEVQLGIPHPGGLKKKRSVTVLDVGDAYFSVPLDESFRKYTA
FTIPSMNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRTQNPDIVIYQYMDDLYV
GSDLEIGQHRAKIEELREHLLRWGFTTPDKKHQKEPPFLWMGYELHPDKWTVQPIQLPEK
ESWTVNDIQKLVGKLNWASQIYPGIRVRHLCKLLRGAKALTDIVPLTEEAELELAENREI
LKEPVHGV

References
Author Title Citation
Non-B Workgroup Impact of HIV-1 subtype and antiretroviral therapy on protease and reverse transcriptase genotype: Results of a global collaboration. PLoS Med, 2005