<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
con15 con15 Brazil 1999 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT+ DDI 205

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
  T215S     K64R, K122T, I135T, E138A, I142V, D177E, I178V, G196R, T200A  
>con15| codons 36-225
EICTEMEKEGKISKIGPENPYNTPVFAIRKKDSTKWRKLVDFRELNKRTQDFWEVQLGIP
HPAGLKKKKSVTVLDVGDAYFSVPLDTDFRKYTAFTIPSTNNATPGVRYQYNVLPQGWKG
SPAIFQSSMTKILEPFRKQNPEVVIYQYMDDLYVGSDLEIRQHRAKIEELRQHLLRWGFS
TPDKKHQKEP

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    G17D, L63P, K70R  
>con15| codons 1-99
PQITLWQRPLVTIKIGDQLKEALLDTGADDTVLEEMNLPGRWKPKMIGGIGGFIKVRQYD
QIPIEICGHRAIGTVLVGPTPVNIIGRNLLTQIGCTLNF

References
Author Title Citation
Machado, ES Genotypic resistance and HIV-1 subtype in Brazilian children on dual and triple combination therapy. J Clin Virol, 2004