<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
con14 con14 Brazil 1999 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT+DDI 26
2 3TC+AZT+RTV 61

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, K70R, M184V       I135T, V179I, T200A, F214L K46T
>con14| codons 36-225
EICTELEKEGTISKIGPENPYNTPVFAIKKKNSTRWRKLVDFRELNKRTQDFWEVQLGIP
HPAGLKKKKSVTVLDVGDAYFSVPLDKDFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKG
SPAIFQSSMTKILEPFRKQNPDIIIYQYVDDLYVGSDLEIGQHRAKIEELRQHLLRWGLT
TPDKKHQKEP

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, I54V, V82A   K14R, I15V, E35D, R41K, L63P  
>con14| codons 1-99
PQITLWQRPLVTIRVGGQLKEALLDTGADDTVLEDMNLPGKWKPKIIGGIGGFVKVRQYD
QIPIEICGHKAIGTVLVGPTPANIIGRNLLTQIGCTLNF

References
Author Title Citation
Machado, ES Genotypic resistance and HIV-1 subtype in Brazilian children on dual and triple combination therapy. J Clin Virol, 2004