<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
con12 con12 Brazil 1999 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT+DDI 48
2 3TC+AZT 37
3 3TC+AZT+RTV 3
4 3TC+D4T+RTV 78

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, V82L F53L L10I, T12S, G16A, E35D, M36I, N37D, I64V, H69K, K70E, V77I, C95S  
>con12| codons 1-99
PQITLWQRPIVSIKIAGQLKEALLDTGADDTVLEDIDLPGRWKPKIIGGIGGLIKVRQYD
QILVEICGKEAIGTVLIGPTPLNIIGRNLLTQIGSTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, M184V, L210W, T215Y K219Q     K104S, T107P, I135T, I202V, E203D, H208Y, R211K, D218A N136T
>con12| codons 36-225
EICTELEKEGKISKIGPENPYNTPVFAIKKKNSTKWRKLVDFRELNKRTQDFWEVQLGIP
HPAGLKKKSSVPVLDVGDAYFSVPLDKDFRKYTAFTIPSTTNETPGIRYQYNVLPQGWKG
SPAIFQSSMTKILEPFRKQNPDIVIYQYVDDLYVGSDLEIGQHRTKVDELRQYLWKWGFY
TPAQKHQKEP

References
Author Title Citation
Machado, ES Genotypic resistance and HIV-1 subtype in Brazilian children on dual and triple combination therapy. J Clin Virol, 2004