<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
cs149 cs149 Brazil 2001 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT+DDI 1
2 3TC+AZT 58
3 3TC+D4T+RTV 106
4 Unknown 6
5 D4T+DDI+EFV 33

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
I54V, V82M L24I L10I, I15V, G17E, L19I, E35D, M36I, N37D, R41K, D60E, Q61E, L63P, H69R  
>cs149| codons 1-99
PQITLWQRPIVTIKVGEQIKEALIDTGADDTVLEDIDLPGKWKPKMIGGIGGFVKVRQYE
EIPIEICGRKAIGTVLVGPTPMNIIGRNLLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M184V       E36D, I142V, K173Q, E203D E53V
>cs149| codons 36-225
DICTEMEKEGKISKIGPVNPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIP
HPAGLKKKKSVTVLDVGDAYFSVPLDKDFRKYTAFTIPSINNETPGVRYQYNVLPQGWKG
SPAIFQSSMTKILEPFRQQNPDIVIYQYVDDLYVGSDLEIGQHRTKIDELRQHLLRWGFT
TPDKKHQKEP

References
Author Title Citation
Machado, ES Genotypic resistance and HIV-1 subtype in Brazilian children on dual and triple combination therapy. J Clin Virol, 2004