<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
cs146 cs146 Brazil 2001 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT 84
2 AZT+ DDI 54
3 AZT+ 3TC+ RTV 156

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, K70R, M184V, T215F V75M     V60I, V90I, I94L, I135T, S162Y  
>cs146| codons 36-225
EICTELEKEGKISKIGPENPYNTPIFAIKKKNSTRWRKLMDFRELNKRTQDFWEIQLGLP
HPAGLKKKKSVTVLDVGDAYFSVPLDKDFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKG
SPAIFQYSMTKILEPFRKQNPDIVIYQYVDDLYVGSDLEIGQHRTKIEELRQHLLRWGFF
TPDKKHQKEP

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
I54V, V82A, L90M Q58E L10I, K20R, M36I, R41K, I62V, L63P, H69R, A71V  
>cs146| codons 1-99
PQITLWQRPIVTIKIGGQLREALLDTGADDTVLEEINLPGKWKPKMIGGIGGFVKVREYD
QVPIEICGRKVIGTVLVGPTPANIIGRNLMTQIGCTLNF

References
Author Title Citation
Machado, ES Genotypic resistance and HIV-1 subtype in Brazilian children on dual and triple combination therapy. J Clin Virol, 2004