<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
cs144 cs144 Brazil 2001 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT+ 3TC 79
2 DDI+ D4T+ 3TC+ EFV 20

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
    K103N   K49R, V90I, D123E, S162C, T200I, Q207E  
>cs144| codons 36-225
EICTEMEKEGKISRIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEIQLGIP
HPAGLKKNKSVTVLDVGDAYFSVPLDKEFRKYTAFTIPSINNETPGIRYQYNVLPQGWKG
SPAIFQCSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRIKIEELREHLLRWGFT
TPDKKHQKEP

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    L63P, C67Y, H69K  
>cs144| codons 1-99
PQITLWQRPLVTIKIGGQLKEALLDTGADDTVLEEMNLPGRWKPKMIGGIGGFIKVRQYD
QIPIEIYGKKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF

References
Author Title Citation
Machado, ES Genotypic resistance and HIV-1 subtype in Brazilian children on dual and triple combination therapy. J Clin Virol, 2004