<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
con03 con03 Brazil 1999 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT+ 3TC 143

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
D67N, K70R, M184V K219Q     T39E, K64R, D121H, K122E, I135T, E169D, D177E, V179I, G196E, T200A, I202V, F214L  
>con03| codons 36-225
EICEEMEKEGKISKIGPENPYNTPVFAIRKKNSTRWRKLVDFRELNKRTQDFWEVQLGIP
HPAGLKKKKSVTVLDVGDAYFSVPLHEDFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKG
SPAIFQSSMTKILDPFRKQNPEIIIYQYVDDLYVGSDLEIEQHRAKVEELRQHLLRWGLT
TPDQKHQKEP

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    I15V, H69Y  
>con03| codons 1-99
PQITLWQRPLVTIKVGGQLKEALLDTGADDTVLEEMNLPGRWKPKMIGGIGGFIKVRQYD
QILIEICGYKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF

References
Author Title Citation
Machado, ES Genotypic resistance and HIV-1 subtype in Brazilian children on dual and triple combination therapy. J Clin Virol, 2004