<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
cs143 cs143 Brazil 2001 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT 103
2 AZT+ DDI 32
3 AZT+ 3TC 113
4 D4T+ 3TC+ NFV 89

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, T69D, M184V, L210W, T215Y       K43Q, V118I, K122E, I135T, S162C, D177N  
>cs143| codons 36-225
EICTELEQEGKISKIGPENPYNTPVFAIKKKNSDKWRKLVDFRELNKRTQDFWEVQLGIP
HPAGLKKKKSVTVLDVGDAYFSIPLDEDFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKG
SPAIFQCSMTKILEPFRKQNPNIVIYQYVDDLYVGSDLEIGQHRTKIEELRQHLWRWGFY
TPDKKHQKEP

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, L90M   L10I, G16E, L19V, K20I, R41K, R57K, A71T, T74S, V77I, Q92K  
>cs143| codons 1-99
PQITLWQRPIVTIKIEGQVIEALLDTGADDTVLEEMNLPGKWKPKIIGGIGGFIKVKQYD
QILIEICGHKTIGSVLIGPTPVNIIGRNLMTKIGCTLNF

References
Author Title Citation
Machado, ES Genotypic resistance and HIV-1 subtype in Brazilian children on dual and triple combination therapy. J Clin Virol, 2004