<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
cs141 cs141 Brazil 2001 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT 22
2 AZT+DDI 36
3 3TC+AZT 31
4 3TC+D4T+RTV 96
5 3TC+D4T+NFV+NVP 64

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, M184I, L210W, T215Y K219R K103N, Y181C   E44D, V118I, K122E, E203K, H208Y, R211K, W212M, K223Q  
>cs141| codons 36-225
EICTELEKDGKISKIGPENPYNTPVFAIKKKNSTKWRKLVDFRELNKRTQDFWEVQLGIP
HPAGLKKNKSVTVLDVGDAYFSIPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKG
SPAIFQSSMTKILEPFRKQNPDIVICQYIDDLYVGSDLEIGQHRTKIKELRQYLWKMGFY
TPDRKHQQEP

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
I84V, L90M F53L L10I, I13V, K20R, E35D, M36I, N37S, R41K, I62V, L63P, I64V, H69Y, A71V  
>cs141| codons 1-99
PQITLWQRPIVTVKIGGQLREALLDTGADDTVLEDISLPGKWKPKMIGGIGGLIKVRQYD
QVPVEICGYKVIGTVLVGPTPVNVIGRNLMTQIGCTLNF

References
Author Title Citation
Machado, ES Genotypic resistance and HIV-1 subtype in Brazilian children on dual and triple combination therapy. J Clin Virol, 2004