<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
cs139 cs139 Brazil 2001 HIV1 F Plasma None

Treatment History
Order Regimen Weeks
1 AZT+ DDI 42
2 AZT+ 3TC 191

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
D67N, K70R, M184V T215V     T39M, I47F, V60I, T69A, V90I, K122E, I135L, S162H, K173T, Q174K, G196E, R211K  
>cs139| codons 36-225
EICMEMEKEGKFSKIGPENPYNTPIFAIKKKNSARWRKLVDFRELNKRTQDFWEIQLGIP
HPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSLNNETPGIRYQYNVLPQGWKG
SPAIFQHSMTKILEPFRTKNPDIVIYQYVDDLYVGSDLEIEQHRTKIEELRQHLLKWGFV
TPDKKHQKEP

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    T12D, K14R, I15V, G16E, L19T, E35D, M36I, P39Q, R41K, R57K, Q61N, L63V, I72T, V77I, L89M, C95S  
>cs139| codons 1-99
PQITLWQRPLVDIRVEGQTKEALLDTGADDTVLEDINLQGKWKPKMIGGIGGFIKVKQYD
NIVIEICGHKATGTVLIGPTPVNIIGRNMLTQIGSTLNF

References
Author Title Citation
Machado, ES Genotypic resistance and HIV-1 subtype in Brazilian children on dual and triple combination therapy. J Clin Virol, 2004