<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
cs138 cs138 Brazil 2001 HIV1 F Plasma None

Treatment History
Order Regimen Weeks
1 AZT 51
2 AZT+ DDI 231

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, K70R, T215Y K219E     T39K, V60I, K102Q, D123E, S162C, E169D, K173A, Q174K, Q207E, R211K K220N
>cs138| codons 36-225
EICKELEKEGKISKIGPENPYNTPIFAIKKKNSTRWRKLVDFRELNKRTQDFWEVQLGIP
HPAGLKQKKSVTVLDVGDAYFSVPLDKEFRKYTAFTIPSINNETPGIRYQYNVLPQGWKG
SPAIFQCSMTKILDPFRAKNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELREHLLKWGFY
TPDENHQKEP

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    K14R, I15V, E35D, M36I, R41K, R57K, Q61N, V77I, L89M, C95S  
>cs138| codons 1-99
PQITLWQRPLVTIRVGGQLKEALLDTGADDTVLEDINLPGKWKPKMIGGIGGFIKVKQYD
NILIEICGHKAIGTVLIGPTPVNIIGRNMLTQIGSTLNF

References
Author Title Citation
Machado, ES Genotypic resistance and HIV-1 subtype in Brazilian children on dual and triple combination therapy. J Clin Virol, 2004