<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
cs135 cs135 Brazil 2001 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 D4T+ 3TC+ NFV 113

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
V32I, M46I, I54V, V82A, L90M K43T L10I, I15V, K20R, M36I, R57K, L63P, A71V, C95S  
>cs135| codons 1-99
PQITLWQRPIVTIKVGGQLREALLDTGADDTILEEINLPGRWTPKIIGGIGGFVKVKQYD
QIPIEICGHKVIGTVLVGPTPANIIGRNLMTQIGSTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, T69D, M184V, L210W, T215Y       V118I, K122E, T139K, I142T, R211K Q145P
>cs135| codons 36-225
EICTELEKEGKISKIGPENPYNTPVFAIKKKNSDKWRKLVDFRELNKRTQDFWEVQLGIP
HPAGLKKKKSVTVLDVGDAYFSIPLDEDFRKYTAFTIPSINNEKPGTRYPYNVLPQGWKG
SPAIFQSSMTKILEPFRKQNPDIVIYQYVDDLYVGSDLEIGQHRTKIEELRQHLWKWGFY
TPDKKHQKEP

References
Author Title Citation
Machado, ES Genotypic resistance and HIV-1 subtype in Brazilian children on dual and triple combination therapy. J Clin Virol, 2004