<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
cs134 cs134 Brazil 2001 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT 80
2 DDI 8
3 3TC+NFV 61
4 3TC+D4T+NFV 153

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, M184V, T215Y       S68G, D121Y, K122E, D123E, I135T, T200I  
>cs134| codons 36-225
EICTELEKEGKISKIGPENPYNTPVFAIKKKDGTKWRKLVDFRELNKRTQDFWEVQLGIP
HPAGLKKKKSVTVLDVGDAYFSVPLYEEFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKG
SPAIFQSSMTKILEPFRKQNPDIVIYQYVDDLYVGSDLEIGQHRIKIEELRQHLLRWGFY
TPDKKHQKEP

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
D30N L10F, N88D T12N, L19V, K20I, E35D, M36I, I64V, A71V, C95S  
>cs134| codons 1-99
PQITLWQRPFVNIKIGGQVIEALLDTGADNTVLEDINLPGRWKPKMIGGIGGFIKVRQYD
QILVEICGHKVIGTVLVGPTPVNIIGRDLLTQIGSTLNF

References
Author Title Citation
Machado, ES Genotypic resistance and HIV-1 subtype in Brazilian children on dual and triple combination therapy. J Clin Virol, 2004