<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
cs133 cs133 Brazil 2001 HIV1 F Plasma None

Treatment History
Order Regimen Weeks
1 AZT+DDI+RTV 155

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
D67N, T215Y K219N     K102Q, D121H, I135T, S162G, E169D, K173M, Q174K, Q207E, L210V, R211K  
>cs133| codons 36-225
EICTEMEKEGKISKIGPENPYNTPVFAIKKKNSTKWRKLVDFRELNKRTQDFWEVQLGIP
HPAGLKQKKSVTVLDVGDAYFSVPLHKDFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKG
SPAIFQGSMTKILDPFRMKNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELREHLVKWGFY
TPDNKHQKEP

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46L, I54V, V82A L24I L10I, K20R, E35D, M36I, R41K, R57K, Q61N, L63P, L89M  
>cs133| codons 1-99
PQITLWQRPIVTIKIGGQLREALIDTGADDTVLEDINLPGKWKPKLIGGIGGFVKVKQYD
NIPIEICGHKAIGTVLVGPTPANIIGRNMLTQIGCTLNF

References
Author Title Citation
Machado, ES Genotypic resistance and HIV-1 subtype in Brazilian children on dual and triple combination therapy. J Clin Virol, 2004