<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
cs200 cs200 Brazil 2002 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT+DDI 91
2 3TC+D4T 3
3 3TC+D4T+RTV 11
4 Unknown 10
5 3TC+D4T+NFV 139

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
D30N, M46I N88D I13V, I15V, K20T, L63P, H69Q, V77I  
>cs200| codons 1-99
PQITLWQRPLVTVKVGGQLTEALLDTGADNTVLEEMNLPGRWKPKIIGGIGGFIKVRQYD
QIPIEICGQKAIGTVLIGPTPVNIIGRDLLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, M184V, L210W, T215Y A62V     K102Q, I135T, S162C, R211K  
>cs200| codons 36-225
EICTELEKEGKISKIGPENPYNTPVFVIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIP
HPAGLKQKKSVTVLDVGDAYFSVPLDKDFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKG
SPAIFQCSMTKILEPFRKQNPDIVIYQYVDDLYVGSDLEIGQHRTKIEELRQHLWKWGFY
TPDKKHQKEP

References
Author Title Citation
Machado, ES Genotypic resistance and HIV-1 subtype in Brazilian children on dual and triple combination therapy. J Clin Virol, 2004